My Store
LL-37 - 10 MG
LL-37 - 10 MG
Couldn't load pickup availability
LL-37 is a human antimicrobial peptide derived from the C-terminal portion of the cathelicidin antimicrobial peptide (hCAP18). It plays a significant role in innate immunity, exhibiting broad-spectrum antimicrobial activity against bacteria, viruses, and fungi. LL-37 is also involved in wound healing, inflammation modulation, and immune cell recruitment. It is widely studied in immunology, infectious disease, dermatology, and regenerative medicine research.
Amino Acid Sequence (Single-Letter Code):
[LL-37, 37 aa]
Disclaimer:
For Research Use Only. Not for Human Consumption. This peptide is intended solely for scientific and laboratory research purposes. It is not approved for medical, diagnostic, or therapeutic use in humans or animals.
Share
