IGF-1 LR3 - 1 MG

IGF-1 LR3 is a synthetic analog of human insulin-like growth factor-1 (IGF-1), modified to enhance stability and biological activity. This analog includes an arginine substitution at position 3 and an extended N-terminal sequence of 13 amino acids, which significantly increases its half-life and reduces binding to IGF-binding proteins. IGF-1 LR3 is widely studied in research on muscle growth, cell proliferation, and repair mechanisms due to its potent anabolic and regenerative properties.

Amino Acid Sequence (Single-Letter Code):
MFPAMPLSSLWALLLLAEPHAPAARGSVPTQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
SSDACGVYRPCQGVDGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

(Note: The full IGF-1 LR3 sequence is 83 amino acids long, compared to the 70 of native IGF-1.)

Disclaimer:
For Research Use Only. Not for Human Consumption. This compound is intended solely for scientific and laboratory research. It is not approved for medical, therapeutic, or diagnostic use in humans or animals.