Skip to product information
1 of 1

My Store

HGH - 10 IU

HGH - 10 IU

Regular price $67.00 USD
Regular price Sale price $67.00 USD
Sale Sold out

Human Growth Hormone (HGH), also known as somatotropin, is a single-chain polypeptide hormone composed of 191 amino acids. It plays a pivotal role in growth, cell regeneration, and metabolism. In scientific research, HGH is studied for its influence on tissue repair, muscle growth, fat metabolism, and overall endocrine system function. The 10 IU format offers a standardized dose for consistent application in laboratory environments.

Amino Acid Sequence (Single-Letter Code):
FPTIPLSRLFDNAMLRDLLRIKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
YNFVYEAETYLEDRSHPIFGPTIPLLAYKQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQK
SNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQ
YFLRDNKVETQX

(Note: Final "X" represents a stop codon or unassigned placeholder in certain representations.)

Disclaimer:
For Research Use Only. Not for Human Consumption. This product is intended strictly for laboratory and scientific research purposes. It is not approved for therapeutic, diagnostic, or clinical use in humans or animals.

View full details