HCG - 5,000 IU

Human Chorionic Gonadotropin (HCG) is a glycoprotein hormone composed of two non-covalently linked subunits: alpha and beta. It is naturally produced in the placenta during pregnancy and is studied for its vital role in reproductive biology. In research contexts, HCG is used to investigate endocrine function, luteinizing hormone activity, and gonadal development.

Amino Acid Sequence (Beta Subunit – Single-Letter Code):
HTPTPSPSRLPGPSDTPILPQPELCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVQGTLFNVTVRVQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNLTCDLFEEIRLMLCAAKCDFSRSVNASLFSKCGPVSMSDGIFTLVKQNCDVCTRVQGPRSA

Disclaimer:
For Research Use Only. Not for Human Consumption. This product is strictly intended for scientific and laboratory research purposes. It is not approved for medical, therapeutic, or diagnostic use in humans or animals.