HCG - 10,000 IU

Human Chorionic Gonadotropin (HCG) is a glycoprotein hormone composed of two subunits: alpha and beta. It plays a crucial role in human reproductive biology and is widely used in scientific studies focused on hormonal regulation, fertility mechanisms, and endocrine signaling. The beta subunit of HCG provides its biological specificity and is a common target in research involving gonadotropins.

Amino Acid Sequence (Beta Subunit, Single-Letter Code):
HTPTPSPSRLPGPSDTPILPQPELCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVQGTLFNVTVRVQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNLTCDLFEEIRLMLCAAKCDFSRSVNASLFSKCGPVSMSDGIFTLVKQNCDVCTRVQGPRSA

(Note: The full HCG molecule also includes the alpha subunit, which is common to LH, FSH, and TSH.)

Disclaimer:
For Research Use Only. Not for Human Consumption. This product is intended exclusively for laboratory and scientific research. It is not approved for therapeutic, diagnostic, or clinical use in humans or animals.