My Store
CJC-1295 (no DAC) - 5 MG
CJC-1295 (no DAC) - 5 MG
Couldn't load pickup availability
CJC-1295 (no DAC) is a synthetic peptide analog of growth hormone-releasing hormone (GHRH), designed to promote increased and more consistent release of growth hormone. Unlike the DAC (Drug Affinity Complex) version, this form has a shorter half-life, allowing for more controlled research conditions and precise dosage studies. It is often utilized in scientific settings to investigate mechanisms of growth hormone regulation, pulsatile secretion, and peptide half-life optimization.
Sequence:
YDAAFIQSYRKLVLAGQLSARLLQDIMSRQQGGGG
Disclaimer:
For Research Use Only. Not for Human Consumption. This product is intended strictly for laboratory research purposes and is not to be used in diagnostic or therapeutic applications. It is not approved by the FDA for human use.
Share
